{"product_id":"proteintech-13318-1-ap","title":"Proteintech, 13318-1-AP, CISD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CISD2 (13318-1-AP) by Proteintech is a Polyclonal antibody targeting CISD2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n13318-1-AP targets CISD2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse brain tissue,  mouse heart tissue,  human brain tissue,  rat kidney tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCISD2 gene encodes a 15 kDa CDGSH iron-sulfur domain-containing protein 2, which is also named Miner1 or NAF-1, this protein was reported on the endoplasmic reticulum membrane or mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2), a rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. CISD2 regulates the autophagy program by interacting with BCL2, contributing to antagonizing BECN1-mediated cellular autophagy at the endoplasmic reticulum.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, drosophila\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4172 Product name: Recombinant human CISD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-135 aa of BC032300 Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV Predict reactive species\nFull Name: CDGSH iron sulfur domain 2\nCalculated Molecular Weight: 135 aa, 15 kDa\nObserved Molecular Weight: 13-15 kDa\nGenBank Accession Number: BC032300\nGene Symbol: CISD2\nGene ID (NCBI): 493856\nRRID: AB_2080270\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5K1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868857553065,"sku":"13318-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13318-1-ap","provider":"Iright","version":"1.0","type":"link"}