{"product_id":"proteintech-13330-1-ap","title":"Proteintech, 13330-1-AP, BUB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BUB1 (13330-1-AP) by Proteintech is a Polyclonal antibody targeting BUB1 in WB, IF\/ICC, ELISA applications with reactivity to human, canine samples\n13330-1-AP targets BUB1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HeLa cells\nPositive IF\/ICC detected in: IMR-90 cells, MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBub1 is an evolutionarily conserved mitotic checkpoint control protein that is present in diverse organisms including yeast and humans. Bub1 is a serine\/threonine protein kinase and is required for recruitment of Mad1, Mad2, Bub3, and CENP-E to kinetochores. Full-length Bub1 protein was cleaved to an 45 kDa fragment and an intermediate fragment of 90 kDa, only detected at early stages of apoptosis execution, indicating cleavage of Bub1 in the amino- and carboxy-terminal regions of the protein(PMID:15818396).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, canine\nCited Reactivity: human, carassius auratus\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4138 Product name: Recombinant human BUB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 785-1083 aa of BC028201 Sequence: KLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCETSGFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRS Predict reactive species\nFull Name: budding uninhibited by benzimidazoles 1 homolog (yeast)\nCalculated Molecular Weight: 1085 aa, 122 kDa\nObserved Molecular Weight: 45 kDa, 120 kDa\nGenBank Accession Number: BC028201\nGene Symbol: BUB1\nGene ID (NCBI): 699\nRRID: AB_2814999\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43683\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868915880105,"sku":"13330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13330-1-ap","provider":"Iright","version":"1.0","type":"link"}