{"product_id":"proteintech-13370-1-ap","title":"Proteintech, 13370-1-AP, TDG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TDG (13370-1-AP) by Proteintech is a Polyclonal antibody targeting TDG in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13370-1-AP targets TDG in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, HEK-293 cells,  HeLa cells,  human brain tissue,  mouse colon tissue,  mouse thymus tissue,  Raji cells,  HCT-116 cells,  Jurkat cells,  K-562 cells,  MCF-7 cells\nPositive IP detected in: U-937 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTDG belongs to the TDG\/mug DNA glycosylase family. TDG corrects G\/T mispairs to G\/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G\/T, it can remove thymine also from C\/T and T\/T mispairs in the order G\/T \u0026gt;\u0026gt; C\/T \u0026gt; T\/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A\/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2\/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4190 Product name: Recombinant human TDG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-410 aa of BC037557 Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA Predict reactive species\nFull Name: thymine-DNA glycosylase\nCalculated Molecular Weight: 410 aa, 46 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC037557\nGene Symbol: TDG\nGene ID (NCBI): 6996\nRRID: AB_2271704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13569\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868937343145,"sku":"13370-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13370-1-ap","provider":"Iright","version":"1.0","type":"link"}