{"product_id":"proteintech-13377-1-ap","title":"Proteintech, 13377-1-AP, Siglec-9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Siglec-9 (13377-1-AP) by Proteintech is a Polyclonal antibody targeting Siglec-9 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n13377-1-AP targets Siglec-9 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, U-937 cells,  mouse skeletal muscle tissue,  A375 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:300-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSialic acid binding Ig-like lectin 9 (Siglec-9), also known as CD329, is a member of the Siglec family of glycan-recognition proteins. Siglec-9 is a type-I transmembrane protein consisting of an N-terminal extracellular region that contains an N-terminal V-set domain and two C2-set domains, a transmembrane region, and an intracellular domain with an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an ITIM-like motif (PMID: 10801862). It is expressed quite broadly among human blood leukocytes, including monocytes, neutrophils, B cells, NK cells, and minor subsets of T cells (PMID: 32322597). Siglec-9 functions as an inhibitory immune checkpoint and can be targeted to enhance therapeutic antitumor immunity (PMID: 34155121; 37460871).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4201 Product name: Recombinant human SIGLEC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-341 aa of BC035365 Sequence: LTCQVTFPGASVTTNKTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPSNPGVLELPWVHLRDEAEFTCRAQNPLGSQQVYLNVSLQSKA Predict reactive species\nFull Name: sialic acid binding Ig-like lectin 9\nCalculated Molecular Weight: 463 aa, 50 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC035365\nGene Symbol: Siglec-9\nGene ID (NCBI): 27180\nRRID: AB_2187293\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y336\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869601583273,"sku":"13377-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13377-1-ap","provider":"Iright","version":"1.0","type":"link"}