{"product_id":"proteintech-13381-1-ap","title":"Proteintech, 13381-1-AP, GLRX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GLRX2 (13381-1-AP) by Proteintech is a Polyclonal antibody targeting GLRX2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13381-1-AP targets GLRX2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HGC-27 cells, MCF-7 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLRX2(Glutaredoxin-2) is also named as GRX2 and belongs to the glutaredoxin family. It facilitates the maintenance of cellular redox homeostasis upon treatment with apoptotic agents, thereby preventing cardiolipin oxidation and cytochrome C release. The GLRX2, which exists in a dynamic equilibrium of enzymatically active monomers and quiescent dimers,is a 16-kDa protein directed either to the nucleus or to the mitochondria through differential splicing of the first exon(PMID: 17121859). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4218 Product name: Recombinant human GLRX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC028113 Sequence: RSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ Predict reactive species\nFull Name: glutaredoxin 2\nCalculated Molecular Weight: 164 aa, 18 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC028113\nGene Symbol: GLRX2\nGene ID (NCBI): 51022\nRRID: AB_10643373\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NS18\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868941340841,"sku":"13381-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13381-1-ap","provider":"Iright","version":"1.0","type":"link"}