{"product_id":"proteintech-13393-1-ap","title":"Proteintech, 13393-1-AP, COX-1\/Cyclooxygenase-1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX-1\/Cyclooxygenase-1 (13393-1-AP) by Proteintech is a Polyclonal antibody targeting COX-1\/Cyclooxygenase-1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13393-1-AP targets COX-1\/Cyclooxygenase-1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Neuro-2a cells,  HeLa cells,  THP-1 cells,  C2C12 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTGS1(Prostaglandin G\/H synthase 1) belongs to the prostaglandin G\/H synthase family and catalyzes the conversion of arachidonic acid to prostaglandin H2, which is subsequently metabolized to various biologically active prostaglandins. It is also named as COX1(Cyclooxygenase-1). There is no PTGS1 expression in fetal samples (prostate, seminal vesicles, or ejaculatory ducts), and only minimal expression in adult tissues (PMID: 10999846). PTGS1 has some isoforms with MW of 56-72 kD and PTGS1 can form homodimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4055 Product name: Recombinant human PTGS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-599 aa of BC029840 Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL Predict reactive species\nFull Name: prostaglandin-endoperoxide synthase 1 (prostaglandin G\/H synthase and cyclooxygenase)\nCalculated Molecular Weight: 599 aa, 69 kDa\nObserved Molecular Weight: 60-72 kDa\nGenBank Accession Number: BC029840\nGene Symbol: PTGS1\nGene ID (NCBI): 5742\nRRID: AB_10644323\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23219\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868854964393,"sku":"13393-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13393-1-ap","provider":"Iright","version":"1.0","type":"link"}