{"product_id":"proteintech-13407-1-ap","title":"Proteintech, 13407-1-AP, SLC19A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC19A3 (13407-1-AP) by Proteintech is a Polyclonal antibody targeting SLC19A3 in WB, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n13407-1-AP targets SLC19A3 in WB, IF, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, SH-SY5Y cells,  mouse skeletal muscle tissue,  mouse kidney tissue,  human placenta tissue,  rat heart tissue,  3T3-L1 cells,  rat liver tissue\nPositive IP detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4053 Product name: Recombinant human SLC19A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-315 aa of BC032014 Sequence: LFLPMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWSLWWAFATAGFNQVLNYVQILWDYKAPSQDSSIY Predict reactive species\nFull Name: solute carrier family 19, member 3\nCalculated Molecular Weight: 496 aa, 56 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC032014\nGene Symbol: SLC19A3\nGene ID (NCBI): 80704\nRRID: AB_2187997\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BZV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921090217,"sku":"13407-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13407-1-ap","provider":"Iright","version":"1.0","type":"link"}