{"product_id":"proteintech-13456-1-ap","title":"Proteintech, 13456-1-AP, MEI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEI1 (13456-1-AP) by Proteintech is a Polyclonal antibody targeting MEI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13456-1-AP targets MEI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human cervical cancer tissue, human urothelial carcinoma tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEI1 may play a role in meiosis during spermatogenesis. It is required for normal meiotic chromosome synapsis. MEI1 may be involved in the formation of meiotic double-strand breaks (DSBs) in spermatocytes. This antibody recognizes isoform 1, 2, 3, 5, and 7 of MEI1 gene with MW 141 kDa,  67-72 kDa,49-54 kDa and 26 kDa .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4253 Product name: Recombinant human MEI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC032248 Sequence: MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN Predict reactive species\nFull Name: meiosis inhibitor 1\nCalculated Molecular Weight: 894 aa, 99 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC032248\nGene Symbol: MEI1\nGene ID (NCBI): 150365\nRRID: AB_2877951\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5TIA1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869708800169,"sku":"13456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13456-1-ap","provider":"Iright","version":"1.0","type":"link"}