{"product_id":"proteintech-13512-1-ap","title":"Proteintech, 13512-1-AP, SNRPB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nSNRPB2 Polyclonal Antibody for WB, IHC, IF\/ICC, IP, ELISA\n13512-1-AP targets SNRPB2 in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  human kidney tissue,  human liver tissue,  mouse liver tissue,  mouse lung tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nU2 small nuclear ribonucleoprotein B''(SNRPB2) is part of the U2 RNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. Only in presence of the U2A' protein, SNRPB2 binds stem loop IV of U2 snRNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4436 Product name: Recombinant human SNRPB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC036737 Sequence: MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK Predict reactive species\nFull Name: small nuclear ribonucleoprotein polypeptide B''\nCalculated Molecular Weight: 225 aa, 26, 5 kDa\nObserved Molecular Weight: 25-31 kDa\nGenBank Accession Number: BC036737\nGene Symbol: SNRPB2\nGene ID (NCBI): 6629\nRRID: AB_2302390\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08579\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921319593,"sku":"13512-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13512-1-ap","provider":"Iright","version":"1.0","type":"link"}