{"product_id":"proteintech-13515-1-ap","title":"Proteintech, 13515-1-AP, MARVELD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MARVELD2 (13515-1-AP) by Proteintech is a Polyclonal antibody targeting MARVELD2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13515-1-AP targets MARVELD2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human small intestine tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMARVELD2, also named as Tricellulin or TRIC, is a 558 amino acid protein, which contains one MARVEL domain. MARVELD2 localizes the cell membrane and plays a role in the formation of the epithelial barriers. MARVELD2, is a first integral membrane protein that is concentrated at the vertically oriented tight junction strands of tricellular contacts. MARVELD2 may be a component to maintain the integrity for peripheral nervous system myelin function and morphology.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4446 Product name: Recombinant human MARVELD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-558 aa of BC033689 Sequence: LWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYS Predict reactive species\nFull Name: MARVEL domain containing 2\nCalculated Molecular Weight: 558 aa, 64 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC033689\nGene Symbol: MARVELD2\nGene ID (NCBI): 153562\nRRID: AB_2281702\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N4S9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868983840937,"sku":"13515-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13515-1-ap","provider":"Iright","version":"1.0","type":"link"}