{"product_id":"proteintech-13526-1-ap","title":"Proteintech, 13526-1-AP, ZnT6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZnT6 (13526-1-AP) by Proteintech is a Polyclonal antibody targeting ZnT6 in WB, ELISA applications with reactivity to human samples\n13526-1-AP targets ZnT6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZnT6 (encoded by SLC30A6) is a member of zinc transporters. ZnT6 is localized on the membrane of the Golgi apparatus as well as cytoplasmic vesicles. It may function in transporting the cytoplasmic zinc into the Golgi apparatus as well as the vesicular compartment. Altered expression of ZnT6 may correlate to neural diseases including Alzheimer's disease. Several isoforms of ZnT6 exist due to the alternative splicing, with MW around 48-56 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, chicken, yellow catfish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4403 Product name: Recombinant human SLC30A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-501 aa of BC032525 Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP Predict reactive species\nFull Name: solute carrier family 30 (zinc transporter), member 6\nCalculated Molecular Weight: 460 aa, 50 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC032525\nGene Symbol: ZnT6\nGene ID (NCBI): 55676\nRRID: AB_2254797\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6NXT4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962181289,"sku":"13526-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13526-1-ap","provider":"Iright","version":"1.0","type":"link"}