{"product_id":"proteintech-13537-1-ap","title":"Proteintech, 13537-1-AP, ACTL7B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACTL7B (13537-1-AP) by Proteintech is a Polyclonal antibody targeting ACTL7B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13537-1-AP targets ACTL7B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue,  human liver tissue,  mouse testis tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACTL7B is also named as actin-like-7-beta. The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. The ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known. Diseases associated with ACTL7B include Dysautonomia and Hypertensive Nephropathy. An important paralog of this gene is ACTL7A. ACTL7B can be detected as 45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4460 Product name: Recombinant human ACTL7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-415 aa of BC033789 Sequence: MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGSVAIYSKC Predict reactive species\nFull Name: actin-like 7B\nCalculated Molecular Weight: 415 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC033789\nGene Symbol: ACTL7B\nGene ID (NCBI): 10880\nRRID: AB_2223776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y614\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869512061097,"sku":"13537-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13537-1-ap","provider":"Iright","version":"1.0","type":"link"}