{"product_id":"proteintech-13557-1-ap","title":"Proteintech, 13557-1-AP, BRUNOL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRUNOL5 (13557-1-AP) by Proteintech is a Polyclonal antibody targeting BRUNOL5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13557-1-AP targets BRUNOL5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, U-251 cells\nPositive IHC detected in: mouse brain tissue, human gliomas tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRUNOL5, also named CELF5, is a 485 amino acid protein, which belongs to the CELF\/BRUNOL family. BRUNOL5 is expressed in the brain and localizes in the nucleus. BRUNOL5 is an RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing and mediates exon inclusion and\/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL5 specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. BRUNOL5 exists in two isoforms with MV 52 and 45 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4416 Product name: Recombinant human BRUNOL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-485 aa of BC028101 Sequence: KLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY Predict reactive species\nFull Name: bruno-like 5, RNA binding protein (Drosophila)\nCalculated Molecular Weight: 485 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC028101\nGene Symbol: BRUNOL5\nGene ID (NCBI): 60680\nRRID: AB_1211624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N6W0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885284708521,"sku":"13557-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13557-1-ap","provider":"Iright","version":"1.0","type":"link"}