{"product_id":"proteintech-13615-1-ap","title":"Proteintech, 13615-1-AP, IFT20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFT20 (13615-1-AP) by Proteintech is a Polyclonal antibody targeting IFT20 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples\n13615-1-AP targets IFT20 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MDCK cells,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse brain tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells, MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium. IFT particles are multi-subunit complexes that are made up of complex A and complex B. IFT20 is a component of IFT complex B and involved in ciliary process assembly. It is associated with the Golgi complex and plays a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse, rat, canine, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4521 Product name: Recombinant human IFT20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC038094 Sequence: MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK Predict reactive species\nFull Name: intraflagellar transport 20 homolog (Chlamydomonas)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15-18 kDa\nGenBank Accession Number: BC038094\nGene Symbol: IFT20\nGene ID (NCBI): 90410\nRRID: AB_2280001\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IY31\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868832747689,"sku":"13615-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13615-1-ap","provider":"Iright","version":"1.0","type":"link"}