{"product_id":"proteintech-13625-1-ap","title":"Proteintech, 13625-1-AP, GMFG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GMFG (13625-1-AP) by Proteintech is a Polyclonal antibody targeting GMFG in WB, IP, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n13625-1-AP targets GMFG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue,  human heart tissue,  human placenta tissue,  mouse placenta tissue\nPositive IP detected in: mouse spleen tissue\nPositive IHC detected in: human lung cancer tissue, human kidney tissue,  human placenta tissue,  human testis tissue,  human spleen tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGMFG, is a highly conserved brain-specific protein that belongs to the GMF subfamily of the larger Actin-binding protein ADF family. GMFG is preferentially expressed in blood vessel cells and immune cells and its ectopic expression enhances cellular functions such as tube-formation and migration in vitro. GMFG mediates neutrophil and T-lymphocyte migration via regulation of actin cytoskeletal reorganization. GMFG also acts as an intracellular regulator of stress-activated signal transduction by demonstrating activation of p38 MAP kinase and transcription factor NF-kB in astrocytes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4538 Product name: Recombinant human GMFG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC032819 Sequence: SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR Predict reactive species\nFull Name: glia maturation factor, gamma\nCalculated Molecular Weight: 141 aa, 17 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC032819\nGene Symbol: GMFG\nGene ID (NCBI): 9535\nRRID: AB_2110929\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60234\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924825769,"sku":"13625-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13625-1-ap","provider":"Iright","version":"1.0","type":"link"}