{"product_id":"proteintech-13637-1-ap","title":"Proteintech, 13637-1-AP, TULP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TULP3 (13637-1-AP) by Proteintech is a Polyclonal antibody targeting TULP3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13637-1-AP targets TULP3 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, SH-SY5Y cells,  HeLa cells,  SK-N-SH cells\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: human ovary cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe tubby-like protein 3 (TULP3) has been identified as a member of tubby and tubby-like proteins (TULPs) that plays an important role in maintenance and function of neuronal cells during development and post-differentiation. Tulp3 gene is essential for embryonic development in mice. Recently TULP3 has been reported to bind to the IFT (intraflagellar transport)-A complex and promote trafficking of G protein-coupled receptors into primary cilia, which is implicated in regulating neuronal function.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4570 Product name: Recombinant human TULP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-442 aa of BC032587 Sequence: DEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDYLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE Predict reactive species\nFull Name: tubby like protein 3\nCalculated Molecular Weight: 442 aa, 50 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC032587\nGene Symbol: TULP3\nGene ID (NCBI): 7289\nRRID: AB_2211547\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75386\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904378537,"sku":"13637-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13637-1-ap","provider":"Iright","version":"1.0","type":"link"}