{"product_id":"proteintech-13646-1-ap","title":"Proteintech, 13646-1-AP, Syntaphilin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Syntaphilin (13646-1-AP) by Proteintech is a Polyclonal antibody targeting Syntaphilin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13646-1-AP targets Syntaphilin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse trachea tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyntaphilin is a protein selectively expressed in brain. Syntaphilin competes with SNAP-25 for binding to syntaxin-1 and inhibits SNARE complex formation by absorbing free syntaxin-1, and thereby regulates synaptic vesicle exocytosis (PMID: 10707983). The deduced 537-amino acid syntaphilin protein contains an N-terminal proline-rich domain, a predicted coiled-coil domain, a putative C-terminal transmembrane domain, and numerous consensus sites for protein phosphorylation. Whereas the calculated molecular mass of syntaphilin is 58 kDa, the apparent molecular mass of 70-75 kDa is larger than the predicted mass, suggesting a posttranslational modification of syntaphilin (PMID: 9205841; 10707983). An extra band of 65 kDa was also detected by this antibody that may represent an alternative syntaphilin gene product or a stable degradation product (PMID: 10707983; 24457644).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4594 Product name: Recombinant human SNPH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-424 aa of BC035788 Sequence: WIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRH Predict reactive species\nFull Name: syntaphilin\nCalculated Molecular Weight: 538 aa, 58 kDa\nObserved Molecular Weight: 70-75 kDa, 65 kDa\nGenBank Accession Number: BC035788\nGene Symbol: SNPH\nGene ID (NCBI): 9751\nRRID: AB_2193555\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15079\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961296553,"sku":"13646-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13646-1-ap","provider":"Iright","version":"1.0","type":"link"}