{"product_id":"proteintech-13675-1-ap","title":"Proteintech, 13675-1-AP, Calpain 11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calpain 11 (13675-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain 11 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n13675-1-AP targets Calpain 11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalpains are a superfamily of related proteins, some of which have been shown to function as intracellular calcium-dependent cysteine proteases. Calpains consist of a variable large (80 kDa) subunit and an invariant small (30 kDa) subunit. The expression of calpain11 during spermatogenesis and its localization is spermatozoa suggest that it is involved in regulating calcium-dependent signal transduction events during meiosis and sperm functional processes(PMID:16541461). And the 110 kDa band protein may be regarded as a complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4668 Product name: Recombinant human CAPN11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 352-702 aa of BC033733 Sequence: YWHTTFYEGSWRRGSSAGGCRNHPGTFWTNPQFKISLPEGDDPEDDAEGNVVACTCLVALMQKNWRHARQQGAQLQTIGFVLYAVPKEFQNIQDVHLKKEFFTKYQDHGFSEIFTNSREVSSQLRLPPGEYIIIPSTFEPHRDADFLLRVFTEKHSESWELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARYADDDLIIDFDSFISCFLRLKTMFTFFLTMDPKNTGHICLSLEQWLQMTMWG Predict reactive species\nFull Name: calpain 11\nCalculated Molecular Weight: 702 aa, 81 kDa\nObserved Molecular Weight: 81 kDa\nGenBank Accession Number: BC033733\nGene Symbol: Calpain 11\nGene ID (NCBI): 11131\nRRID: AB_2069480\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UMQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885771772073,"sku":"13675-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13675-1-ap","provider":"Iright","version":"1.0","type":"link"}