{"product_id":"proteintech-13676-1-ap","title":"Proteintech, 13676-1-AP, WDR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR1 (13676-1-AP) by Proteintech is a Polyclonal antibody targeting WDR1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13676-1-AP targets WDR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat skeletal muscle tissue,  mouse skeletal muscle,  Jurkat cells,  U-87 cells\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IHC detected in: human colon tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF\/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4670 Product name: Recombinant human WDR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC030541 Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG Predict reactive species\nFull Name: WD repeat domain 1\nCalculated Molecular Weight: 606 aa, 66 kDa\nObserved Molecular Weight: 66-70 kDa\nGenBank Accession Number: BC030541\nGene Symbol: WDR1\nGene ID (NCBI): 9948\nRRID: AB_10697831\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75083\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938293417,"sku":"13676-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13676-1-ap","provider":"Iright","version":"1.0","type":"link"}