{"product_id":"proteintech-13690-1-ap","title":"Proteintech, 13690-1-AP, NEDD4L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEDD4L (13690-1-AP) by Proteintech is a Polyclonal antibody targeting NEDD4L in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13690-1-AP targets NEDD4L in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, HT-1080 cells,  PC-3 cells,  PC-12 cells\nPositive IP detected in: C6 cells\nPositive IHC detected in: human stomach cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEDD4L(E3 ubiquitin-protein ligase NEDD4-like) is also named as KIAA0439, NEDL3, Nedd4-2. It accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substratesand and is the principal ubiquitin ligase that selectively targets activated SMAD2 and SMAD3 for destruction (PMID:19917253). Nedd4L binds the PY motif of ENaC COOH terminals and catalyzes ubiquitination of the NH2 terminus of the protein for subsequent degradation (PMID:18268134). It has some isoforms produced by alternative splicing. This antibody may have cross reaction with NEDD4 due to the high homology of the antigen.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4565 Product name: Recombinant human NEDD4L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 565-911 aa of BC032597 Sequence: EESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD Predict reactive species\nFull Name: neural precursor cell expressed, developmentally down-regulated 4-like\nCalculated Molecular Weight: 854 aa, 96 kDa\nObserved Molecular Weight: 112 kDa, 125 kDa\nGenBank Accession Number: BC032597\nGene Symbol: NEDD4L\nGene ID (NCBI): 23327\nRRID: AB_2149326\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PU5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868841201833,"sku":"13690-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13690-1-ap","provider":"Iright","version":"1.0","type":"link"}