{"product_id":"proteintech-13691-1-ap","title":"Proteintech, 13691-1-AP, HERC4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HERC4 (13691-1-AP) by Proteintech is a Polyclonal antibody targeting HERC4 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13691-1-AP targets HERC4 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human brain tissue,  human placenta tissue,  human testis tissue,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHERC4, also known as HECT and RLD domain containing E3 ubiquitin protein ligase 4, is a protein encoded by the HERC4 gene in humans. HERC4 is a novel member of HERC family. The mRNA of HERC4 has been found in all examined tissues, with its levels being significantly higher in the brain and testis than in the placenta and heart. (PMID: 28430527)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4566 Product name: Recombinant human HERC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 723-1049 aa of BC039600 Sequence: NIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLI Predict reactive species\nFull Name: hect domain and RLD 4\nCalculated Molecular Weight: 1049 aa, 118 kDa\nObserved Molecular Weight: 107 kDa\nGenBank Accession Number: BC039600\nGene Symbol: HERC4\nGene ID (NCBI): 26091\nRRID: AB_10596480\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5GLZ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869548204201,"sku":"13691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13691-1-ap","provider":"Iright","version":"1.0","type":"link"}