{"product_id":"proteintech-13726-1-ap","title":"Proteintech, 13726-1-AP, AUP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AUP1 (13726-1-AP) by Proteintech is a Polyclonal antibody targeting AUP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13726-1-AP targets AUP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HEK-293 cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAUP1 (Ancient ubiquitous protein 1) is a protein associated with lipid metabolism, which is widely expressed on the surface of ER and Lipid droplets, involved in the degradation of misfolded proteins through autophagy (PMID: 37029364). In addition, AUP1 also controls lipid synthesis as it induces ubiquitination and the subsequent degradation of several key regulators of lipid biosynthesis, such as the cholesterol biosynthetic enzyme 3-hydroxy-3-methylglutaryl-coenzyme A reductase (PMID: 28330944).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4680 Product name: Recombinant human AUP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-437 aa of BC033646 Sequence: LLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD Predict reactive species\nFull Name: ancient ubiquitous protein 1\nCalculated Molecular Weight: 416 aa, 45 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC033646\nGene Symbol: AUP1\nGene ID (NCBI): 550\nRRID: AB_2258768\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y679\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947402921,"sku":"13726-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13726-1-ap","provider":"Iright","version":"1.0","type":"link"}