{"product_id":"proteintech-13729-1-ap","title":"Proteintech, 13729-1-AP, CACNG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CACNG3 (13729-1-AP) by Proteintech is a Polyclonal antibody targeting CACNG3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13729-1-AP targets CACNG3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  mouse kidney tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVoltage-dependent calcium channels couple membrane depolarization in a number of cellular processes. These activities are regulated by distinct channels composed of alpha-1, beta, alpha-2\/delta, and gamma subunits. CACNG3, one of the eight gamma subunits in human, is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4730 Product name: Recombinant human CACNG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 202-315 aa of BC040005 Sequence: EKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV Predict reactive species\nFull Name: calcium channel, voltage-dependent, gamma subunit 3\nCalculated Molecular Weight: 315 aa, 36 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC040005\nGene Symbol: CACNG3\nGene ID (NCBI): 10368\nRRID: AB_2070085\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60359\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869648933033,"sku":"13729-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13729-1-ap","provider":"Iright","version":"1.0","type":"link"}