{"product_id":"proteintech-13732-1-ap","title":"Proteintech, 13732-1-AP, CD99L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD99L2 (13732-1-AP) by Proteintech is a Polyclonal antibody targeting CD99L2 in WB, ELISA applications with reactivity to human samples\n13732-1-AP targets CD99L2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD99L2 (CD99 molecule like 2), also known as CD99B and MIC2L1, is a type 1 transmembrane protein that is similar to CD99 (PMID: 12706889). It is expressed on most leukocytes and several other cell types including neuronal cells (PMID: 12706889). CD99L2 may function as a homophilic adhesion molecule as well as play a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane (PMID: 37199607). Its related pathways respond to elevated platelet cytosolic Ca2+ and cell surface interactions at the vascular wall.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3809 Product name: Recombinant human CD99L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-113 aa of BC025729 Sequence: TLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISA Predict reactive species\nFull Name: CD99 molecule-like 2\nCalculated Molecular Weight: 262 aa, 28 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC025729\nGene Symbol: CD99L2\nGene ID (NCBI): 83692\nRRID: AB_3669170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TCZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886389285033,"sku":"13732-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13732-1-ap","provider":"Iright","version":"1.0","type":"link"}