{"product_id":"proteintech-13740-1-ap","title":"Proteintech, 13740-1-AP, DUT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUT (13740-1-AP) by Proteintech is a Polyclonal antibody targeting DUT in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n13740-1-AP targets DUT in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human liver tissue,  human kidney tissue,  HEK-293 cells,  Ramos cells,  A549 cells,  HepG2 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4677 Product name: Recombinant human DUT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-164 aa of BC033645 Sequence: MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN Predict reactive species\nFull Name: deoxyuridine triphosphatase\nCalculated Molecular Weight: 252 aa, 27 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC033645\nGene Symbol: DUT\nGene ID (NCBI): 1854\nRRID: AB_2093170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P33316\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869403893929,"sku":"13740-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13740-1-ap","provider":"Iright","version":"1.0","type":"link"}