{"product_id":"proteintech-13743-1-ap","title":"Proteintech, 13743-1-AP, RNMT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNMT (13743-1-AP) by Proteintech is a Polyclonal antibody targeting RNMT in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n13743-1-AP targets RNMT in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human kidney tissue,  HeLa cells,  human liver tissue\nPositive IP detected in: L02 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRNMT, also named as mRNA cap guanine-N7 methyltransferase or KIAA0398, is a 476 amino acid protein, which contains one mRNA cap 0 methyltransferase domain and belongs to the class I-like SAM-binding methyltransferase superfamily. mRNA cap 0 methyltransferase family. RNMT localizes in the nucleus and is widely expressed in various tissues. RNMT as a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs and binds RNA containing 5'-terminal GpppC.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4682 Product name: Recombinant human RNMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-476 aa of BC036798 Sequence: KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ Predict reactive species\nFull Name: RNA (guanine-7-) methyltransferase\nCalculated Molecular Weight: 476 aa, 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC036798\nGene Symbol: RNMT\nGene ID (NCBI): 8731\nRRID: AB_2181550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43148\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988035241,"sku":"13743-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13743-1-ap","provider":"Iright","version":"1.0","type":"link"}