{"product_id":"proteintech-13765-1-ap","title":"Proteintech, 13765-1-AP, PCYT1B\/PCYT1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCYT1B\/PCYT1A (13765-1-AP) by Proteintech is a Polyclonal antibody targeting PCYT1B\/PCYT1A in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n13765-1-AP targets PCYT1B\/PCYT1A in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, human brain tissue\nPositive IP detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCYT1B (Phosphate Cytidylyltransferase 1B, Choline), also named as CTβ, CCTB and CCT-Beta, is encoded by the gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. PCYT1B encodes three isoforms of CTβ (CTβ1, CTβ2 and CTβ3). CTβ1, CTβ2 isoforms are present in humans and CTβ2 and CTβ3 isoforms have been identified in mice. The CTβ2 can be detected as 41 kDa, and CTβ3 can be detected as 39 kDa. This antibody can recognizes both PCYT1A and PCYT1B. PCYT1A usually exists in the form of a 80 kDa dimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4748 Product name: Recombinant human PCYT1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC045634 Sequence: MVGNQECIMEEDNRAPQLWRKTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK Predict reactive species\nFull Name: phosphate cytidylyltransferase 1, choline, beta\nCalculated Molecular Weight: 351 aa, 40 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC045634\nGene Symbol: PCYT1B\nGene ID (NCBI): 9468\nRRID: AB_10642953\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5K3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869725315241,"sku":"13765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13765-1-ap","provider":"Iright","version":"1.0","type":"link"}