{"product_id":"proteintech-13787-1-ap","title":"Proteintech, 13787-1-AP, EAF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EAF1 (13787-1-AP) by Proteintech is a Polyclonal antibody targeting EAF1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13787-1-AP targets EAF1 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HeLa cells,  mouse brain tissue\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELL associated factor 1 and ELL associated factor 2 (EAF1\/2 factors) are reported to play important roles in tumor suppression and embryogenesis.\nThe tumor suppressor EAF2 is regulated by androgen signaling and associated with prostate cancer. Eaf factors have been revealed to modulate mesoderm and neural patterning by inhibiting canonical Wnt signaling, and high activity of canonical Wnt\/β-catenin is revealed in eafs morphants (PMID: 23364330).\nCatalog#13787-1-AP is a rabbit polyclonal antibody raised against the full-length of human EAF1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4804 Product name: Recombinant human EAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC041329 Sequence: MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD Predict reactive species\nFull Name: ELL associated factor 1\nCalculated Molecular Weight: 268 aa, 29 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC041329\nGene Symbol: EAF1\nGene ID (NCBI): 85403\nRRID: AB_2255402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96JC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996980905,"sku":"13787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13787-1-ap","provider":"Iright","version":"1.0","type":"link"}