{"product_id":"proteintech-13791-1-ap","title":"Proteintech, 13791-1-AP, Spartin\/SPG20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Spartin\/SPG20 (13791-1-AP) by Proteintech is a Polyclonal antibody targeting Spartin\/SPG20 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n13791-1-AP targets Spartin\/SPG20 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  PANC-1 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPG20 (spastic paraplegia 20) gene encodes a multifunctional Spartin protein. SPG20 protein is highly expressed in adipose tissue and may be implicated in endosomal trafficking and microtubule dynamics. SPG20 is mutated in Troyer syndrome, a hereditary spastic paraplegia defined by degeneration of upper motor neurons, recent study showed that regulation of SPG20 on mitochondrial calcium homeostasis may contribute to the pathophysiology of Troyer syndrome. Hypermethylation of SPG20 promoter, found in colorectal cancer patients, may play a role in cytokinesis arrest in colorectal tumorigenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4815 Product name: Recombinant human Spartin, SPG20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC047083 Sequence: MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI Predict reactive species\nFull Name: spastic paraplegia 20 (Troyer syndrome)\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 75-84 kDa\nGenBank Accession Number: BC047083\nGene Symbol: Spartin\nGene ID (NCBI): 23111\nRRID: AB_2195683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N0X7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904050857,"sku":"13791-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13791-1-ap","provider":"Iright","version":"1.0","type":"link"}