{"product_id":"proteintech-13806-1-ap","title":"Proteintech, 13806-1-AP, TSSK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSSK2 (13806-1-AP) by Proteintech is a Polyclonal antibody targeting TSSK2 in WB, ELISA applications with reactivity to human samples\n13806-1-AP targets TSSK2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSSK2 (Testis-Specific Serine\/Threonine Kinase 2) is a member of the TSSK family, predominantly expressed in the testis and involved in spermiogenesis and male fertility. It is localized in various regions of sperm, including the centrioles of post-meiotic spermatids, the tail, acrosomal regions, and the midpiece. TSSK2 plays a crucial role in sperm maturation by phosphorylating substrates such as TSKS and SPAG16L. Studies have shown that TSSK2 knockout mice exhibit infertility due to impaired spermatid elongation and sperm maturation. Additionally, TSSK2 is considered a promising target for reversible male contraception, with several potent inhibitors identified through high-throughput screening.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4805 Product name: Recombinant human TSSK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC037781 Sequence: MDDATVLRKKGYIVGINLGKGSYAKVKSAYSERLKFNVAVKIIDRKKTPTDFVERFLPREMDILATVNHGSIIKTYEIFETSDGRIYIIMELGVQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLDIVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQPKVYD Predict reactive species\nFull Name: testis-specific serine kinase 2\nCalculated Molecular Weight: 358 aa, 41 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC037781\nGene Symbol: TSSK2\nGene ID (NCBI): 23617\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PF2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887909589161,"sku":"13806-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13806-1-ap","provider":"Iright","version":"1.0","type":"link"}