{"product_id":"proteintech-13822-1-ap","title":"Proteintech, 13822-1-AP, ARP3\/ARP3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARP3\/ARP3B (13822-1-AP) by Proteintech is a Polyclonal antibody targeting ARP3\/ARP3B in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n13822-1-AP targets ARP3\/ARP3B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse spleen tissue,  human liver tissue,  A549 cells,  HL-60 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  PC-3 cells\nPositive IP detected in: mouse spleen tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARP3 (also known as ACTR3) is a major constituent of the ARP2\/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4922 Product name: Recombinant human ACTR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-418 aa of BC044590 Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS Predict reactive species\nFull Name: ARP3 actin-related protein 3 homolog (yeast)\nCalculated Molecular Weight: 418 aa 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC044590\nGene Symbol: ARP3\/ACTR3\nGene ID (NCBI): 10096\nRRID: AB_2221967\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61158\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868900053161,"sku":"13822-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13822-1-ap","provider":"Iright","version":"1.0","type":"link"}