{"product_id":"proteintech-13919-1-ap","title":"Proteintech, 13919-1-AP, VILIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VILIP1 (13919-1-AP) by Proteintech is a Polyclonal antibody targeting VILIP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n13919-1-AP targets VILIP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse tongue tissue,  human brain tissue,  rat brain tissue,  HeLa cells,  mouse cerebellum tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: Human bowens diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4923 Product name: Recombinant human VSNL1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-191 aa of BC022012 Sequence: MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK Predict reactive species\nFull Name: visinin-like 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22-24 kDa\nGenBank Accession Number: BC022012\nGene Symbol: VSNL1\nGene ID (NCBI): 7447\nRRID: AB_2215851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869508325545,"sku":"13919-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13919-1-ap","provider":"Iright","version":"1.0","type":"link"}