{"product_id":"proteintech-13967-1-ap","title":"Proteintech, 13967-1-AP, IFT88 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFT88 (13967-1-AP) by Proteintech is a Polyclonal antibody targeting IFT88 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples\n13967-1-AP targets IFT88 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, NIH\/3T3 cell,  MDCK cells,  mouse thymus tissue\nPositive IP detected in: knockout cells and WT cells,  HEK-293 cells\nPositive IHC detected in: mouse heart tissue, human pancreas tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: hTERT-RPE1 cells, MDCK cells,  C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88\/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, mouse, rat, pig, canine, chicken, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE Predict reactive species\nFull Name: intraflagellar transport 88 homolog (Chlamydomonas)\nCalculated Molecular Weight: 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC030776\nGene Symbol: IFT88\nGene ID (NCBI): 8100\nRRID: AB_2121979\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13099\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868820459689,"sku":"13967-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13967-1-ap","provider":"Iright","version":"1.0","type":"link"}