{"product_id":"proteintech-13977-1-ap","title":"Proteintech, 13977-1-AP, YES1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe YES1 (13977-1-AP) by Proteintech is a Polyclonal antibody targeting YES1 in IP, IHC, ELISA applications with reactivity to human samples\n13977-1-AP targets YES1 in IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: A431 cells\nPositive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nYES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily.  It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP\/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5016 Product name: Recombinant human YES1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-526 aa of BC048960 Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL Predict reactive species\nFull Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC048960\nGene Symbol: YES1\nGene ID (NCBI): 7525\nRRID: AB_2877998\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925711017,"sku":"13977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-13977-1-ap","provider":"Iright","version":"1.0","type":"link"}