{"product_id":"proteintech-14015-1-ap","title":"Proteintech, 14015-1-AP, STAG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAG1 (14015-1-AP) by Proteintech is a Polyclonal antibody targeting STAG1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14015-1-AP targets STAG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  human heart tissue,  Raji cells,  Jurkat cells,  MCF-7 cells,  NIH\/3T3 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAG1, also named as SCC3 homolog 1, is a 1258 amino acid protein, which belongs to the SCC3 family. STAG1 interacts directly with RAD21 in cohesin complex and localizes in nucleus. STAG1 is a Component of cohesin complex, which is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. The calculate molecular weight of STAG1 is 144 kDa, but modified STAG1 is about 145-150 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5123 Product name: Recombinant human STAG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 880-1221 aa of BC064699 Sequence: IVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKGRPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEHGSEPDFLHNRGLMEEDAEPIFEDVMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF Predict reactive species\nFull Name: stromal antigen 1\nCalculated Molecular Weight: 144 kDa\nObserved Molecular Weight: 155 kDa\nGenBank Accession Number: BC064699\nGene Symbol: STAG1\nGene ID (NCBI): 10274\nRRID: AB_2194759\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WVM7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869605810345,"sku":"14015-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14015-1-ap","provider":"Iright","version":"1.0","type":"link"}