{"product_id":"proteintech-14021-1-ap","title":"Proteintech, 14021-1-AP, AADACL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AADACL1 (14021-1-AP) by Proteintech is a Polyclonal antibody targeting AADACL1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14021-1-AP targets AADACL1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human brain tissue,  human kidney tissue,  human lung tissue,  human ovary tissue,  human skin tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAADACL1(Arylacetamide deacetylase-like 1) is also named as NCEH1, KIAA1363 and belongs to the 'GDXG' lipolytic enzyme family. The transmembrane enzyme, AADACL1, controls the production of the monoalkylglycerol ether (MAGE) class of NELs in cancer cells and acts as a 2-acetyl MAGE hydrolase and is likely the principal source for this activity in tumor cells(PMID:21513884). The full length protein has three glycosylation sites and can be N-glycosylated(PMID:19159218). It has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5136 Product name: Recombinant human AADACL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 83-435 aa of BC047588 Sequence: SHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL Predict reactive species\nFull Name: arylacetamide deacetylase-like 1\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC047588\nGene Symbol: AADACL1\nGene ID (NCBI): 57552\nRRID: AB_2034888\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PIU2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975812777,"sku":"14021-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14021-1-ap","provider":"Iright","version":"1.0","type":"link"}