{"product_id":"proteintech-14040-1-ap","title":"Proteintech, 14040-1-AP, ACRV1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACRV1 (14040-1-AP) by Proteintech is a Polyclonal antibody targeting ACRV1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14040-1-AP targets ACRV1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells,  LNCaP cells,  PC-3 cells\nPositive IP detected in: DU 145 cells\nPositive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe protein ACRV1, also known as SP-10, is an acrosomal matrix protein, which is evolutionarily conserved among mammals. It is associated with the matrix of the acrosomal vesicle in developing spermatids and the acrosomal matrix and membranes of ejaculated sperm (PMID: 8288254). Human ACRV1 protein has 11 isoforms, and molecular weight ranges from 9 to 28 kDa. ACRV1 was predominantly located in round and elongated spermatids in the testis, indicating that ACRV1 may play an important role in mammalian spermatogenesis and may be a target of a contraceptive vaccine (PMID: 21488928; 8874713).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5109 Product name: Recombinant human ACRV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC014588 Sequence: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI Predict reactive species\nFull Name: acrosomal vesicle protein 1\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 13-36 kDa\nGenBank Accession Number: BC014588\nGene Symbol: ACRV1\nGene ID (NCBI): 56\nRRID: AB_10640426\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P26436\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868883570857,"sku":"14040-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14040-1-ap","provider":"Iright","version":"1.0","type":"link"}