{"product_id":"proteintech-14102-1-ap","title":"Proteintech, 14102-1-AP, CNOT7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNOT7 (14102-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n14102-1-AP targets CNOT7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCnot7, Ccr4-Not complex 7, is a component of CCR4-NOT complex and known to be a transcription factor and a modulator of mRNA degradation in yeast. Mammalian Cnot7 interacts with Tob and its family members, which is known as an inhibitor of BMP signaling through interfering with the Smad system and is involved in bone metabolism [PMID:17451368]. It is one of at least 8 subunits that make up the CCR4-Not transcription complex, which is involved in negative regulation of the pol II directed transcription in yeast24 and may be involved inglobal gene regulation by modulation of TATAA-binding protein (TBP) activity [PMID:10880468].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5235 Product name: Recombinant human CNOT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-285 aa of BC060852 Sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS Predict reactive species\nFull Name: CCR4-NOT transcription complex, subunit 7\nCalculated Molecular Weight: 285 aa, 33 kDa\nObserved Molecular Weight: 33-35 kDa\nGenBank Accession Number: BC060852\nGene Symbol: CNOT7\nGene ID (NCBI): 29883\nRRID: AB_2245087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UIV1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939767977,"sku":"14102-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14102-1-ap","provider":"Iright","version":"1.0","type":"link"}