{"product_id":"proteintech-14153-1-ap","title":"Proteintech, 14153-1-AP, IL-18BP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-18BP (14153-1-AP) by Proteintech is a Polyclonal antibody targeting IL-18BP in WB, ELISA applications with reactivity to human, mouse, rat samples\n14153-1-AP targets IL-18BP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL18BP, also named as adekinig-alfa, has 3 isoforms (Isoform A 21kd; B 12kd and D 17kd).  Isoform A binds to IL-18 and inhibits its activity. IL18BP functions as an inhibitor of the early TH1 cytokine response. Highly glycosylated of IL18BP will migrate to be 40kd. A 58kd protein is IL18BP crosslinked IL18.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5335 Product name: Recombinant human IL-18BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-194 aa of BC044215 Sequence: ATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG Predict reactive species\nFull Name: interleukin 18 binding protein\nCalculated Molecular Weight: 194 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC044215\nGene Symbol: IL-18BP\nGene ID (NCBI): 10068\nRRID: AB_2918034\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95998\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869697265833,"sku":"14153-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14153-1-ap","provider":"Iright","version":"1.0","type":"link"}