{"product_id":"proteintech-14156-1-ap","title":"Proteintech, 14156-1-AP, SLC26A11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC26A11 (14156-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A11 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14156-1-AP targets SLC26A11 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, unboiled mouse brain tissue,  mouse kidney tissue,  unboiled mouse kidney tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC26A11 is a sodium-independent sulfate transporter from high endothelial venules (PMID: 12626430). SLC26A11 exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC) (PMID: 12626430). SLC26A11 is critical for inhibitory transmission and contributes to locomotor coordination in Purkinje cells (PMID: 27390771). SLC26A11, a chloride transporter, localizes with the vacuolar H+-ATPase of A-intercalated cells of the kidney and can be detected at 72kDa (PMID: 21716257).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5338 Product name: Recombinant human SLC26A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 463-606 aa of BC035900 Sequence: MLLHSAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELLQDFQKQGVALAFVGLQVPVLRVLLSADLKGFQYFSTLEEAEKHLRQKPGTQPYNIREDSILDQKVALLKA Predict reactive species\nFull Name: solute carrier family 26, member 11\nCalculated Molecular Weight: 606 aa, 65 kDa\nObserved Molecular Weight: 65-72 kDa\nGenBank Accession Number: BC035900\nGene Symbol: SLC26A11\nGene ID (NCBI): 284129\nRRID: AB_3085430\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86WA9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805190313,"sku":"14156-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14156-1-ap","provider":"Iright","version":"1.0","type":"link"}