{"product_id":"proteintech-14163-1-ap","title":"Proteintech, 14163-1-AP, BET1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BET1L (14163-1-AP) by Proteintech is a Polyclonal antibody targeting BET1L in WB, IHC, ELISA applications with reactivity to human, mouse samples\n14163-1-AP targets BET1L in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  K-562 cells,  MCF-7 cells\nPositive IHC detected in: human cervical cancer tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5351 Product name: Recombinant human GS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC032779 Sequence: MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAHGVRVSVPCPSTTCCRACSVSFSTGAGGWSNHHFCVILLGFLP Predict reactive species\nFull Name: blocked early in transport 1 homolog (S. cerevisiae)-like\nCalculated Molecular Weight: 102 aa, 11 kDa\nObserved Molecular Weight: 13-15 kDa\nGenBank Accession Number: BC032779\nGene Symbol: BET1L\nGene ID (NCBI): 51272\nRRID: AB_2064737\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885224284329,"sku":"14163-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14163-1-ap","provider":"Iright","version":"1.0","type":"link"}