{"product_id":"proteintech-14226-1-ap","title":"Proteintech, 14226-1-AP, S100A9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A9 (14226-1-AP) by Proteintech is a Polyclonal antibody targeting S100A9 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n14226-1-AP targets S100A9 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, human blood,  human heart tissue,  MCF-7 cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human breast cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A9 is a calcium binding protein as a member of the S100 family of proteins. S100 proteins are low molecular weight (9 to 14 kDa) intracellular calcium-binding proteins that control key cellular pathways including regulation of the cytoskeleton, cell migration and adhesion, and host oxidative defense. S100A9 may exist as a homodimer, heterodimer (24 kDa) with an S100A8 partner (S100A8\/A9), or as a heterotetramer (28 kDa) with an S100A8 partner(S100A8\/A9). S100A8 and S100A9 are found intracellularly in granulocytes, monocytes, and early differentiation stages of macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5465 Product name: Recombinant human S100A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC047681 Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species\nFull Name: S100 calcium binding protein A9\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 14 kDa, 28 kDa\nGenBank Accession Number: BC047681\nGene Symbol: S100A9\nGene ID (NCBI): 6280\nRRID: AB_2254232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06702\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908540073,"sku":"14226-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14226-1-ap","provider":"Iright","version":"1.0","type":"link"}