{"product_id":"proteintech-14244-1-ap","title":"Proteintech, 14244-1-AP, MMP19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP19 (14244-1-AP) by Proteintech is a Polyclonal antibody targeting MMP19 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14244-1-AP targets MMP19 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells,  human placenta tissue\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMP19(matrix metalloproteinase-19) has the capacity to degrade several basement membrane proteins such as type IV collagen, laminin, tenascin C, and nidogen. It is expressed by microvascular endothelial cells in vitro as well as by capillaries in the inflamed synovial membrane, whereas its expression is absent in quiescent macrovascular endothelial cells of large arteries and veins . And it is also detected in capillaries of normal mammary tissue, benign mammary carcinomas and in skin capillaries(PMID:15241558).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5501 Product name: Recombinant human MMP19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-508 aa of BC050368 Sequence: RIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY Predict reactive species\nFull Name: matrix metallopeptidase 19\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57-60 kDa\nGenBank Accession Number: BC050368\nGene Symbol: MMP19\nGene ID (NCBI): 4327\nRRID: AB_10637857\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99542\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868942946473,"sku":"14244-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14244-1-ap","provider":"Iright","version":"1.0","type":"link"}