{"product_id":"proteintech-14247-1-ap","title":"Proteintech, 14247-1-AP, FAM3C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM3C (14247-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3C in WB, IHC, ELISA applications with reactivity to human samples\n14247-1-AP targets FAM3C in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, human brain tissue,  human heart tissue,  HEK-293 cells,  HT-29 cells,  HepG2 cells\nPositive IHC detected in: human pancreas tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM3C, also known as ILEI, is a secreted protein belonging to the cytokine-like protein family. FAM3C is a signaling cytokine with a GG domain, hydrophobic leader sequence and an N-terminal signal peptide. A change in expression of this protein has been noted in pancreatic cancer-derived cells. FAM3C has been involved in the epithelial to mesenchymal transition, and retinal laminar formation processes in vertebrates. Also, FAM3C may play an important role in inner ear development and thus be involved in cell differentiation and proliferation during inner ear embryogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5516 Product name: Recombinant human FAM3C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-227 aa of BC046932 Sequence: KMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD Predict reactive species\nFull Name: family with sequence similarity 3, member C\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC046932\nGene Symbol: FAM3C\nGene ID (NCBI): 10447\nRRID: AB_2278149\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92520\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933607593,"sku":"14247-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14247-1-ap","provider":"Iright","version":"1.0","type":"link"}