{"product_id":"proteintech-14260-1-ap","title":"Proteintech, 14260-1-AP, CNIH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNIH2 (14260-1-AP) by Proteintech is a Polyclonal antibody targeting CNIH2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n14260-1-AP targets CNIH2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, Rat brain tissue,  Mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCNIH2, or cornichon family AMPA receptor auxiliary protein 2, is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype.CNIH2 has been reported to interact with the Type I AMPA Receptor regulatory protein isoform gamma-8, which controls the assembly of hippocampal AMPA receptor complexes, thereby modulating receptor gating and pharmacology. It has been implicated in various diseases, including schizophrenia, as indicated by its association with different schizophrenia-related disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5533 Product name: Recombinant human CNIH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC047953 Sequence: MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWC Predict reactive species\nFull Name: cornichon homolog 2 (Drosophila)\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC047953\nGene Symbol: CNIH2\nGene ID (NCBI): 254263\nRRID: AB_3669181\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PI25\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886681903273,"sku":"14260-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14260-1-ap","provider":"Iright","version":"1.0","type":"link"}