{"product_id":"proteintech-14273-1-ap","title":"Proteintech, 14273-1-AP, SRXN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRXN1 (14273-1-AP) by Proteintech is a Polyclonal antibody targeting SRXN1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n14273-1-AP targets SRXN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse liver tissue,  Transfected HEK-293 cells,  HepG2 cells,  U-251 cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human lung cancer tissue,  human breast cancer tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5613 Product name: Recombinant human SRX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC047707 Sequence: MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ Predict reactive species\nFull Name: sulfiredoxin 1 homolog (S. cerevisiae)\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC047707\nGene Symbol: SRXN1\nGene ID (NCBI): 140809\nRRID: AB_2195030\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYN0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853522601,"sku":"14273-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14273-1-ap","provider":"Iright","version":"1.0","type":"link"}