{"product_id":"proteintech-14329-1-ap","title":"Proteintech, 14329-1-AP, TSPAN33 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN33 (14329-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN33 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14329-1-AP targets TSPAN33 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  human plasma tissue\nPositive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN33 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN33 belongs to the TSPANC8 subfamily, which also include TSPAN5, TSPAN10, TSPAN14, TSPAN15, and TSPAN17. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5597 Product name: Recombinant human TSPAN33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 116-236 aa of BC044244 Sequence: FVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNL Predict reactive species\nFull Name: tetraspanin 33\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 64-72 kDa\nGenBank Accession Number: BC044244\nGene Symbol: TSPAN33\nGene ID (NCBI): 340348\nRRID: AB_10644331\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UF1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869782364329,"sku":"14329-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14329-1-ap","provider":"Iright","version":"1.0","type":"link"}