{"product_id":"proteintech-14340-1-ap","title":"Proteintech, 14340-1-AP, PALB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PALB2 (14340-1-AP) by Proteintech is a Polyclonal antibody targeting PALB2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14340-1-AP targets PALB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  THP-1 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPALB2 can interact with BRCA1 and BRCA2 and form the BRCA1-PALB2-BRCA2 complex which is critical for homologous recombination and DNA damage response. PALB2 is an essential partner of BRCA2 that promotes the localization and stability of BRCA2. The predicted MW of PALB2 is approximately 130 kDa, while the truncated PALB2 protein arround 80-90 kDa can also be detected in SDS-PAGE similar to papers. (PubMed:16793542, 24141787, 24153426). There's the dimer form with MW 250-260 kDa (refer to PMID: 30289697).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5654 Product name: Recombinant human PALB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 841-1186 aa of BC044254 Sequence: TAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCSSDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLLFIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS Predict reactive species\nFull Name: partner and localizer of BRCA2\nCalculated Molecular Weight: 131 kDa\nObserved Molecular Weight: 130 kDa; 80-90 kDa; 250-260 kDa\nGenBank Accession Number: BC044254\nGene Symbol: PALB2\nGene ID (NCBI): 79728\nRRID: AB_2158774\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868959002793,"sku":"14340-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14340-1-ap","provider":"Iright","version":"1.0","type":"link"}