{"product_id":"proteintech-14354-1-ap","title":"Proteintech, 14354-1-AP, USP15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP15 (14354-1-AP) by Proteintech is a Polyclonal antibody targeting USP15 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14354-1-AP targets USP15 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse brain tissue,  HepG2 cells,  K-562 cells,  MCF-7 cells,  NIH\/3T3 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human placenta tissue, human breast cancer tissue,  human lung tissue,  human ovary tumor tissue,  mouse kidney tissue,  rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUbiquitin is a highly conserved eukaryotic protein that is synthesized as a fusion protein precursor, either to itself or to one of two ribosomal proteins. USP15, is also named as KIAA0529,Unph-2, Unph4, encoding a human ubiquitin-specific protease (USP). The USP15 protein contains the highly conserved Cys and His boxes present in all members of he UBP family of deubiquitinating enzymes(PMID:10444327).It has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5703 Product name: Recombinant human USP15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC020688 Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC Predict reactive species\nFull Name: ubiquitin specific peptidase 15\nCalculated Molecular Weight: 112 kDa\nObserved Molecular Weight: 112 kDa\nGenBank Accession Number: BC020688\nGene Symbol: USP15\nGene ID (NCBI): 9958\nRRID: AB_2257148\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4E8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827308201,"sku":"14354-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14354-1-ap","provider":"Iright","version":"1.0","type":"link"}