{"product_id":"proteintech-14398-1-ap","title":"Proteintech, 14398-1-AP, LDHD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LDHD (14398-1-AP) by Proteintech is a Polyclonal antibody targeting LDHD in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14398-1-AP targets LDHD in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HepG2 cells,  rat liver tissue\nPositive IHC detected in: human liver cancer tissue, human osteosarcoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTwo naturally occurring forms of lactate dehydrogenase with similar but unique substrate specificities have been isolated in lower organisms including invertebrates, fungi, and prokaryotes. These dehydrogenase enzymes are L-lactate dehydrogenase and D-lactate dehydrogenase (LDHD) that are specific to the L and D isomers of lactate, respectively (PMID: 12127981). In lactic acid bacteria, LDHD plays a key role in anaerobic energy metabolism (PMID: 497162). Despite the identification of D-lactate and other D-2-hydroxyacids in prokaryotes, and the obvious connections and similarities to vertebrate metabolic pathways, very few mammalian D-2-hydroxyacid dehydrogenases have been found. LDHD has 2 isoforms with the molecular weight of 52 and 54kDa, and can be detected as 45-54 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5897 Product name: Recombinant human LDHD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-507 aa of BC047902 Sequence: GADASLCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRGRHFRFGFWPEIPHHTAWYSPCVSLGRRKSAAGYNLTGLFVGSEGTLGLITATTLRLHPAPEATVAATCAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWAKEAEERSRLWTARHNAWYAALATRPGCKGYSTDVCVPISRLPEIVVQTKEDLNASGLTGSIVGHVGDGNFHCILLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL Predict reactive species\nFull Name: lactate dehydrogenase D\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 45-54 kDa\nGenBank Accession Number: BC047902\nGene Symbol: LDHD\nGene ID (NCBI): 197257\nRRID: AB_2249831\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86WU2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869554790569,"sku":"14398-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-14398-1-ap","provider":"Iright","version":"1.0","type":"link"}